PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01137.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 392aa    MW: 43153.8 Da    PI: 6.8351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01137.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-184186147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W+teEd  l ++v +lG+++W++Iar ++ gR++k+c++rw + 
  Rsa1.0_01137.1_g00007.1 41 KGPWSTEEDAVLTKLVSKLGPRNWSLIARGIP-GRSGKSCRLRWCNQ 86
                             79******************************.***********985 PP

2Myb_DNA-binding45.61.6e-14112150747
                              HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              eEd  ++ a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
  Rsa1.0_01137.1_g00007.1 112 EEDRMIISAHAIHGNK-WAVIAKLLP-GRTDNAIKNHWNST 150
                              9***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.2533691IPR017930Myb domain
SuperFamilySSF466894.12E-2838147IPR009057Homeodomain-like
SMARTSM007174.6E-154089IPR001005SANT/Myb domain
PfamPF002497.4E-174186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-214297IPR009057Homeodomain-like
CDDcd001674.41E-144385No hitNo description
PROSITE profilePS5129420.678102155IPR017930Myb domain
SMARTSM007172.3E-10105153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-18111152IPR009057Homeodomain-like
CDDcd001672.85E-11112151No hitNo description
PfamPF002498.3E-13112150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MDRSVPLPFA SSAADSDEVI ITAGDSSGGG GGGYEMKSKV KGPWSTEEDA VLTKLVSKLG  60
PRNWSLIARG IPGRSGKSCR LRWCNQLDPC LKRKPFSGPP VRIKIRTGAE HEEDRMIISA  120
HAIHGNKWAV IAKLLPGRTD NAIKNHWNST LRRKYSDLWK NNSQCMAANQ VTTAYIKNEN  180
VEQGLPQEEI ISPPEAPQVV DAAMYDEPTT QVVDVTMDDA PPPNEPQERV DHIEESSIPV  240
FRPVARAGAF RVYNPTSQRN GYRDHNVVPC EGPLIQAAKP DSLAGKFLQS LCGEPNIPSK  300
CGHGCSTHPA ESGKSVLGAE FVDYEEPCPV FNQELISIAT DLNNIAWIKS GLDNTIVREA  360
EQSLKMDHIS FNDPRIKFSG MMPRQHFFCA RS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-36401543104C-Myb DNA-Binding Domain
1msf_C2e-36401543104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747540.0KF974754.1 Brassica napus MYB transcription factor 109-1 (MYB109-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013712506.10.0PREDICTED: uncharacterized protein LOC106416209 isoform X3
TrEMBLM4CSJ40.0M4CSJ4_BRARP; Uncharacterized protein
STRINGBra007186.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.10.0myb domain protein 109